PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00064348001
Common NameGSBRNA2T00064348001, LOC106369019
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 293aa    MW: 33424.6 Da    PI: 8.9674
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00064348001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.8e-3853113262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vPvG+grrknk++s
  GSBRNA2T00064348001  53 PTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKNKNNS 113
                          67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3639110IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3155111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.37957111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MLESKDPAIK LFGMKIPLSS TVFEAEEYEL SAEQNQNETL TDQSDKEKNL KKPTKILPCP  60
RCNSMETKFC YYNNYNVNQP RHFCKACQRY WTSGGTMRSV PVGAGRRKNK NNSSSHYRHV  120
TINETNGPVL SFNLRDDHKT LEKNNHQPVD NSRTRNNEMN GLRCIPGVSW PYTWNHGFYP  180
VYPYWNVPMV SSSPYSTPNS TLGKHSREED ETIKRKQMNG SVLVPKTLRI DDPNEAAKSS  240
IWTTLGIKNE VMFKGFDSKK EVSINKEETE TSLVLCANPA ALSRSVNFHE QM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895970.0AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013664572.10.0PREDICTED: cyclic dof factor 1-like
SwissprotQ8W1E31e-160CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A078JIW20.0A0A078JIW2_BRANA; BnaAnng24480D protein
STRINGBra029261.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-161cycling DOF factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]